PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.4G273600.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 581aa    MW: 63356.8 Da    PI: 4.8109
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.4G273600.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like69.36.1e-22103154355
             G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         r++Wt +LHe+F++a+e L G ++A P  il+lm+vkgLt +++ SHLQk+Rl
  Seita.4G273600.4.p 103 RVKWTIDLHEKFLDAIEVL-GDKNAKPEGILKLMNVKGLTSKQISSHLQKHRL 154
                         99*****************.9*******************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.44998157IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.4E-21100156IPR009057Homeodomain-like
SuperFamilySSF466891.09E-14102158IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-17103154IPR006447Myb domain, plants
PfamPF002491.3E-6103153IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MGAYDDEEAI SEHVALGACS HVLKPLHAGS LNILKQKALE HKFKKATPQG PISSRTQSRM  60
VSSFTKRPQE MLVLDRNDLP NPGSNEFEVP KVRKARGSEK PGRVKWTIDL HEKFLDAIEV  120
LGDKNAKPEG ILKLMNVKGL TSKQISSHLQ KHRLLQRNAK QGGQHQRNAS RKPVSELIGS  180
AHNAATTESI TPTVDADSRE VYPSRLWTQV KEAAVLKTCM YTCASGIYRG DRKSVWDEYE  240
KDLQKDFSTS SRRWQQIGVP LSKCQLPVKN NVVIDAGVSS EALKAAGEIG YGASIESSDS  300
SSLSAGLVDQ VGENNRTKAA GINDNVGNIN LLEGTMNKEH TAASDPSDLF AFLQSNNVDL  360
LGPPYGREED TPYWMSQPLE GLQNQQNLGL EDPLQVDDAW NKGLASLNLI NIDGPMTQEA  420
TVQNAPQEAT IQNDPVNNPV MPIAQDDGLS LVQQYLGLED LLQVDNAWNK GLASPSVVNI  480
DGPMAQEGTI QNPPAHNPEK PIAQDDGFSQ DQQNLGLEDL LQVDNEWNKG LASPSVINID  540
GPMAQAGTIQ NPPAHNPVKP TAQDDEFWSW SPLGDFDMLI *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660566.10.0PREDICTED: uncharacterized protein LOC101775816
TrEMBLK3XXQ60.0K3XXQ6_SETIT; Uncharacterized protein
STRINGSi006714m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.26e-14response regulator 1